JingWen's

Gone fishing

2011-12-28T20:45:00.001+08:00

Thought that you were a good enough reason for me to stay, but I realize that that was the weakest thought ever. You were not the full reason why I chose to leave, but it is because of what was happening that made me bring forward the date.

To think I even felt sad for you, for not being able to stay by your side as a friend to help you, but I guess to you, I am the actual cause of whats happening. I even stupidly helped her by not saying out whatever that is really happening and now everybody thinks I'm the one maligning her.

So this is how much our friendship is worth?

That being said, I think I'm coming back to blogger soon.

2011-07-22T01:47:00.001+08:00

Lost Generation

2011-07-18T19:14:00.000+08:00

"And all of these will come true unless we choose to reverse it."

I like her voice!

Rebel.

2011-07-14T11:44:00.000+08:00

Few fridays back, spotted at Rebel with the usual suspects, but its a pity we're down by one this time. Poor Yanyan had some rash and couldn't join us :(

Thought we could finally have a reunion after both of them went on their seperate holidays.

Meh.

Our sad sad faces when we were raided barely an hour after stepping in. HAHAHAHAH MAJOR FOL.

It was really like random, the lights were on and we, being noobs were like "Huh what happen? Raid?" moments later there came this funny voice "REBEL THIS IS A POLICE RAID"

Sad but a little funny. I was getting a little frustrated cus I had my first drink and was just getting a teeeeeny bit high and I had to stfu. Hahah but to be honest, the voice quite funny ya, the tone and all.

For some reason I just wasn't high enough that night after my 2 drinks and went onto order a tequila shot which was

H.O.R.R.I.B.L.E!!

Whoever who served me forgot about my card so I got really pissed and gave my super black face.

Anyway, tbh, I think Rebel's crowd really slightly more fun and better looking than Powerhouse one teehee. But PH has someone there whom I'll be going back for lah, unbeatable lol!

Alright, time to do some work, wtf I have been sleeping a lot recently and not doing any work.

Harry Potter TOMORROW, SO HYPED UP!!!!!!!

Harry Potter and the Deathly Hallows

2011-07-12T00:49:00.000+08:00

Mr. Harry Potter,

Thank you for remaining strong when we couldn’t be.

Mr. Ronald Weasley,

Thank you for always coming back.

Miss Hermione Granger,

Thank you for having a good heart.

Mr. George Weasley,

Thank you for finding humor when we could barely smile.

Mr. Percy Weasley,

Thank you for believing in the power of family.

Mr. Albus Dumbledore,

Thank you for lighting the way.

Mr. Dudley Dursley,

Thank you for seeing kindness.

Mr. & Mrs. Weasley,

Thank you for all you sacrificed.

Mr. Sirius Black and Mr. Remus Lupin,

Thank you for your loyalty.

Mr. Rubeus Hagrid,

Thank you for your undying compassion.

Mr. Neville Longbottom,

Thank you for your bravery.

Miss Luna Lovegood,

Thank you for your wise words.

Dobby- free elf,

Thank you for showing us the value of friendship.

Mr. Fred Weasley,

Thank you for the memories.

And to Mr. Severus Snape,

Thank you for your love.

And to Mrs. Joanne Kathleen Rowling,

Thank you for my childhood.

Short update

2011-07-06T01:32:00.000+08:00

Sometime ago, my impromptu meeting with YJ for dinz at Bakerzin!

We are super boliao and ordered 4 desserts as dinner!! I think I have a soft spot for dessert. You give me, I'll down it. HAHAHAHA!

Super shiok! Creme Brulee, Pana Cotta, Irsh Creme scouffle and this caramelised apple thing.

Homnomnom! Totally satisfied my food cravings!!

--------------------------------------------------------------------------------------------------

And this, a while ago for Mich Lim's birthday. Stupid girl got super drunk after some drink!

Alright, Im so sleepy cus there's work tomorrow! Just thought I should keep this space alive.

Meowsies,

Wednesday.

2011-06-30T01:49:00.000+08:00

Nothing beats a bag of home made popcorn and some quiet time at home with my fave Nini! Looks like someone needs a hair cut huh.

Sometimes,

2011-06-29T00:31:00.002+08:00

I think my face quite cb... HAHAHAHHAHAHAH

Ultimate.

Can't rmb if I was trying to say the F word or I was just shocked.

It just dwelled on me how much I've changed, from being treated as just a normal passerby, or even receiving dirty, discriminating stares, I realised how successful my transformation has been now that people actually notice me on first look or even bother take a second look.

But I need more changes in my life.

I want more from myself.

Term 2!

2011-06-27T00:28:00.000+08:00

There's just something I really like about this picture, feels like the lost-in-crowded-place kinda feeling.

Its officially past midnight which means term 2 has begun. Lesson starts at 9 tomorrow and I don't want to fall asleep in my first lec/tut for the term! Time to update playlist and do some workkkk.

Good luck to y'all!

Exams, new term and stuff.

Meowx

2011-06-25T23:01:00.001+08:00

I love my pets.

Meows.

Motivation.

2011-06-25T22:08:00.001+08:00

"The only way of finding the limits of the possible, is by going beyond them into the impossible."

Feeling rather alright now, my mood's a lil better. But still facing the same resignation dilemna. On one hand I really want to quit, one saturday without work felt like heaven, but on the other I don't think I can bear to.

But I'm already too exhausted to do my best or anything.

And just now, my mum excitedly came in and asked if I was really gonaa quit tomorrow (cus I told her Im really tired and I want a break). I broke her heart and said I haven't decided.

Thought of waiting till Janet gives birth... or until Freda rejoins uniqlo... or until the new HP UT is out... HIAK HIAK HP UT.

But I really don't know if I can last that long. I don't feel like I can actually focus on so many things all at the same time. Sigh, can someone just please tell me what to do?!

Need new motivation. Need to lose all the weight I've been gaining. Need to concentrate.

Bye, will be back with photos soon! Sorry for the chunk of words.

Powerhouse.

2011-06-21T00:50:00.001+08:00

I haven't exactly been depressed or anything! My absence in this space was due to my hectic workshift :(

So, my holidays have started every since the clock struck 10 on Friday morning (10th June!) but I barely have the time to do the things I like thanks to my stupid 51hours-workweek.

Yes it was fucking insane! Well, it was suppose to be 42hours, which would've been okay but I switched my off day till this week and overworked myself.

Really regretting it now that there's only one week of holidays left, of course which most of my days are gna be dedicated to working again. Like d'ohhhhhh.

Really hate myself sometimes, its not like I am in desperate need of $$.

Not like my family will die of hunger if I don't work.

Not like my flat will be gone if I don't work.

Not like I won't have money to get on with life if I don't work.

Its not like I really give much damn about it anymore.

Its just so demanding, I'm tired.

But I did suspect if it was only cus I was spending so much time at work thats why Im tired. Maybe things will be a lot better when school reopens and I work less and balance work and studies?

Urghhhh, just really feel like lazing around at home right now. Don't feel like going to work or doing my project at all.

URGHHHHHH!

Angst aside, here are some pictures from when I went crubbing with some of my girls sometime ago.

Hahah pictures are not in order cus I stole them from Mich's fb. Album is privated due to some reason... so here's the only place you can view these!

It was the CCN day and we were just suppose to have a peaceful night out watching movie and ending it off with some drinks, but I was feeling upset and wanted to get high so we found ourselves at StJames.

We had vodka cranberry and stupid Kaya wanted beer. I was never a fan of beer, blehz they make me really bloated and they're bitter! But I got high pretty quickly cus she kept saying "CHUG CHUG CHUG"

Like wtf, act smart only, drink hard liquour alr chug beer, siao.

True enough I got high pretty quickly, but the highness went away pretty quickly too. By the time we left, I was already almost fully sober.

Wa see KY's neh neh so big here HAHAHAHAHAHAHAHHAHAHHAHA!

Well, I'm actually pretty skeptical about entering clubs with a younger age group cus the previous time @ Attica, my drinks were all free. Well, someway or other, cousin buy, bartender give, people offer, I never lifted a finger to sign for it.

Of course it isn't so much about being cheapo and not being able to afford my own drinks. Sure I can, its just that I don't feel like it?

The two different places actually caters to different age group I guess. The former has more foreigners who are mostly older than me while the latter's crowd is pretty much my age.

Okay I'm starting to not get what I'm saying. Work tomorrow, shall just finish uploading my pictures and head to bed.

Sigh, I will give my resignation serious thoughts.

2011-06-12T00:03:00.001+08:00

True that.

Gna go workout in a bit, fuck I can't believe how much weight I gained in these few days.

I'm mad angry with myself now, bye.

Contrast.

2011-06-08T16:55:00.002+08:00

Is it me or are contrasting colours pwetty?

Think colour bloc, yin and yang, white and black, yummeh.

One paper down, two more to go.

Today's paper sucked and my next paper's not till.. exactly 21hrs55minutes later.

That being said, I wasted my whole afternoon sleeping and shopping online. Getting worried with my shopping addictions, been spending a lot. Way too much.

Whoops 21 hours 53minutes left.

Adios people, best of luck.

1B16 class chalet

2011-06-07T12:26:00.000+08:00

Well, technically speaking this isn't really a class chalet.... But oh well.

God its been damn longggg can't even rmb. The clothes I packed are like fugly cus it was meant to be light. Plus, I was around people Im comfortable with so I didn't give much shit what I was wearing HAHAHA.

So qt hor their hoodie.

Anyway we were choosing the little prezzies Delick got us from his OCP at Vietnam. Haha I think I'm secretly envious of people who dare to travel overseas for community work.

I mean, I ever thought of like going to Africa or smth alone/with a group of people to maybe like help build school or something. Y'know, just lead the simple life while helping others.

But the thought of not having clean water, proper food and developed country's amenities kinda freaked me out >:

I am weak!!!!!

Anyway, the tiny pillows. Teehee, okay but I think I lost mine, :(

Some random shot of me wearing my uselessly thin cardigan cus I thought I look good in this pic HAHAHAH

MICROWAVED POPCORN!!!

I think our staple food there is like microwave popcorn + maggie please.

And the amount of food we eat everyday is mad scary! Haha its like someone is bound to be eating constantly! And microwave popcorn is so yummehz and convenient, I now have a constant supply at home, teehee.

Played MJ every other day, till like 3am or smth I think before we had some girly talk before falling asleep. The bed was damn squeezy with 4 of us! Haha

T'was day 2 already! All washed up and ready for BBQ, make up and all. Or I'll look super cui in my jersey + shorts hahaha.

Sat at this tiny swing outside our chalet and took photos!! Luvluv.

Then we headed down to the beach with our rented bikes, which was quite cheap.

More arcades to kill time before BBQ and we completed TimeCrisis!!! Haha that game never fails to get me excited!

MEET NIGGA CORN HAHAHAHAH

Took a group shot with SM's cam but I feel really lazy to go kope pictures from fbbbbbbb.

Finally, day 3 and time to leave!

Goodbye sun, swing, late night MJ, endless aircorn and sea breeze!

Really glad that we have this chalet even tho it wasn't really really successful. Cus that was one of the best moments I had with my clique of friends. Our ability to accept each others' differences and put up with one another's nonsense.

Love you guys loads!!!

xxxxxxxxxxx

We're like dominoes,

2011-06-06T02:34:00.000+08:00

Some pictures from a while ago, my dear LF's suprise and belated birthday celebration.

Feels like after we've split our ways we're too busy to even meet up. And this year's the big A for LF, which makes me really scared to ask her out.

But thankfully, April/March'12 is only in a few months, hopefully our Taiwan trip actually succeeds, eggcited much!!

Heh, luving my red polka dot dress.

But currenly swearing off all bright coloured top, if you know what happened. If you don't, too bad.

Pictures are not in order, and yes, once again, I am so damn late in publishing my photos online. Feels like after that incident I haven't actually gotten time for myself.

Oh well, MidSems this week. Gotta finish this shit and spend sometime alone on Friday to save my wardrobe and depleting bank account. Well, of course unless # asks me out!

But I wouldn't mind getting this heh.

Need new motivation in life, need it bad.

Been charging so much to my credit card, think I already hit 6xx in barely a month. How awesome? Talk about being financially independent. Oh well, time to pioritise!

Much as I love my bangs, I really miss my old side fringe :(

Yup, I should really study instead of going online. Tomorrow must be productive, go me go.

Meow,

We're like dominoes,

I fall for you, you fall for her.

It takes a miracle for 2 to fall for each other at the same time.

LOOK GOOD, FEEL GOOD! INNERSHINE!

2011-05-30T17:12:00.001+08:00

So, if you're a TP student, even more, a business student, you'd have known that the Year 2 Marketing students are coming up with a campaign.

Yup, thats right!

Brand's Innershine drink!

You can read more about this health drink HERE!

Of course this is not an advertorial, but rather, just a shoutout to anyone reading this who will be in TP tomorrow. My dear girls, QiuYi and ShiMin's group are having their booth tomorrow! If I'm not wrong its just outside the library from 11AM-2PM!

So what's with the buzz, the booth and the shoutout?

Here's what!

Simply come in groups of 5, sample BRANDS Innershine Prune Essence, complete a SHORT survey and stand to win amazing shopping vouchers - TOPSHOP, G2000, Dorothy Perkins, DIVA and Yoshinoya!

First 100 only!

Y'know, I never knew how much youths these days actually hate prune juice? I mean, of course I'm not a fan but if its actually good for you and doesn't taste like....... some weird bitter chinese medicine,

THEN WHY NOT?

I think the girls are rather worried that after today's group did their Innershine, the students will shun whichever booth coming up next. If you ask me, at the most I'll just got a cup and gulp it down!

One shot, one mouth, no struggle!

Whats more, you even stand a chance to win Topshop vouchers okay!!!

But thats not all!!

A Pruney Affair :

Showcase your creativity through A Pruney Affair!

All you need to do is choose a theme, & pose for the camera! We will pick the picture that best portrays the benefits of the BRANDS Innershine Prune Essence and he/she will win 10 awesome shopping vouchers !

You win not only 1, but 10 AWESOME SHOPPING VOUCHERS!!

Think: Topshop, Dorothy Perkins, Miss Selfridge and Ben Sherman! 20% might not be a lot but hey at least its still some money!

And its so simple! Just get a sample of the drink with your friends, pose for a picture and viola! The easiest way to look good, camwhore and win vouchers!

So don't wait, head down to the booth tomorrow okay!!

TUESDAY 31ST MAY 2011

11AM-2PM

Temasek Polytechnic Business School Entrance

Be there or be square.

Look good,

Feel good,

INNERSHINE!

slavedriver1993

2011-05-28T16:48:00.000+08:00

Currently at Starbucks, armed with yet another mug of americano and laptop. Tons of tabs, tons of word doc, tons of paper lying around me.

Somehow my progress for this sem just seem soooooo freaking slow. Dammit I don't even know whats wrong with me. And I figured the only time when I can finally have a proper rest is on Tuesday night after my socio test.

Finally seeing some light in Sociology, better not do badly for this upcoming major test cus my quiz was rather okay.

Sorry for just feeding you guys with my webcam imagessssss. Really lazy to upload pictures from my camera.

Sigh, I have so much to rant about but I'm really running out of time. Torturous job commitment meant that I have to work 10AM-8PM tmrw.

Wth rightttttt, I am so siannnnn!

Where is my sugar daddyyyyyy?!

Okay last warning to my eyebag and dark circles. Get the fuck outta my face!!!

One word: Projects

2011-05-26T03:46:00.000+08:00

Sorry for the lack of update!!

Been tied down even when its just 2 mere projects. Feeling totally useless now cus I use to be able to juggle work, school and multiple projects all at one shot.

And after my submission comes my tests and all, which made me realise that I can't have a single day to just hiberate at home and catch up on the lack of sleep.

WHY LIDDAT?!?!?!

Feeling really sleepy right now, been sleeping on the couch for the past 2 days, felt like forever since I last slept on my bed lor wtf.

Just wna hug # to bed, listen to his voice and lie on his shoulder and drift into dreamland.

Wanderlust.

2011-05-18T18:47:00.001+08:00

Today. Wednesday.

Halfway through the week with project deadlines drawing nearer yet I'm still lost as a sheep.

Fucking mistaken the date for my private make up tutorial with my CDS teacher and shes refusing to let me take the test already. Walauuuuuuu damn dulan now wtf cus its part of the assesment lor?!

Kp lor why am I so fucking careless/!??!?!?!?!??!?!?! PekChek!!!!!!!

On a side note, this is the first time I'm showing pictures of my new fringe! Yups, got bangs like finally!!! Regretted it the previous round but not this time, heh cus I can act cute with it HAHAHA.

Project in the morning = sad me

Only had like 5-6hours of sleep the night before. Sorta back to exercising cus people have been telling me very depressing stuff. HAHAHA, nah kidding I think its time I went back to being healthy(ier)

Pwetty with colours againnnnnn! My fave having duo combinations heh.

Kristy headless yeo.

Considering that I only had 1 lesson today, which I left halfway, twice, today was chill as fuck.

Went back to work after one whole week off and suddenly I'm damn glad to be back in school. And my current class isn't too bad as well, kinda like them.

Meet my pumpkinz!

Haha so glad that I can share so many things with her. Okay but she just left home for dinz and Im gna be stuck in the lib till 9PM or until I feel that I can take a rest.

Lonelygal1993 signing off!
xoxo

Date with my favourite people.

2011-05-15T13:19:00.043+08:00

Im aware that I haven't updated this space for a while, well pardon me for my lack of responsibility but so many things have been happening I just really don't know where or what to start on.

I don't think I was this sad when I broke up with that bastard lor wtf?

Sometimes I wish I was like Christopher, freed from all the complicated things in the world, especially emotions.

Anyway I'm not gna talk about all the sad stuff, just a short update to show you guys I'm still alive and just to get those kaching kaching rolling in.

Speaking of money... Oh god everything that has been happening has drained so much of my energy I took the whole week off work. Plus I'm gna be working my ass off for my projects for the next 2 weeks,

I think my May pay will be pathetic.

Well, fret not for I can still rely on my debtors and my awesome credit card. Yups, got that as my birthday present from my mum.

And just to disappoint you I haven't maxed it out. Its a freaking platinum *flaunts* (okay kidding about the flaunting, I was pretty shocked she got me a platinum anyway) and I haven't even hit a 4digit spending. But just to disappoint my mum, more nights out and I'll prove the previous sentence right.

Dindin with my favest people on the world.

Thankew all for your support during those times when I need you girls the most. And thank you for listening to me talk about my infidelity, luv u gals bery much.

The night was still young, my mind was still wandering and my heart, still sinking so I called my dear Xiao Yan Zi out for a drink. Sho qt hor *pinch*

We hopped from places to places and I still refuse to step into Rebel. See, self control. Okay kidding, I just felt that I was gna waste my time there.

The night ended with us sitting by the river, munching on snacks and talking till we're sober and no longer high. And I think I high-texted my guy friend while bar-hoping, fml.

Spent the entire morning uploading pictures, mainly from my birthday chalet so do check it out on fb!

On a side note, I hope I lose my appetite forever.

Well, time to wake myself up, being weak is not an option, gna get started and be a slave driver again.

Till then, xoxo

*blows flying kisses*

Harry Potter and the Deathly Hallows - Part 2 trailer

2011-04-30T11:24:00.000+08:00

OMFG OMFG OMFG OMFG YOU'VE GOT TO WATCH THIS!!!!

Part of me really wants to catch it but part of me wish that it didn't end. Nearly teared while watching it omfg omfg so exciting omfg I think Im gna hyperventilate!!!!

SHIT OMG OMG FUCKING EXCITED!!!

So am I forgiven for not updating regularly? HAHAHAHAH

Sem 2.1 Day 1

2011-04-25T23:50:00.000+08:00

So, today marks the official start of the new term, new sem, new year. Which also means that I am officially a year 2 student.

Celebrated my 18th a while ago and suddenly I feel so old. 3 consecuitive nights of drinking, tons of presents and well wishes, really really really appreciate each and everyone of you for making my day memorable for me.

Some photos from just now. Heh love my outfit today!

Anyway I've got some problem with my timetable. Fucking CDS clashes with everything. Really fucking upset now. So troublesome to go through everything. Hoping that the teacher will listen to my excuse tmrw and approve my Col&Com request!

Anyway, my appeal wasn't entirely unsuccessful. It was, I just wanted another one so I've decided not to take Basic Calculus. I've heard many horrific stories bout it and the most common being:

"If you never take AMaths before, DON'T take B.Cal"

Even my brother says so.

So yup, not gna risk anything. I'd rather make it up some other sem than risk it this sem! Fucking hate math..

Google image-d just how bad BCal would be and...

LO AND BEHOLD!

DA FUCK?!?!??!

Asking me to do all these rules shit again is like killing me man. Srsly.

Fucking hate Maths. HATE HATE HATE!!!!

Oh well, the dowager, aka my mum has given me the green light to just drop the fucking shitzz.

Awesome mum I have. She's damn understanding about it this time. Scarily understanding. Can't express how shock I feel bout it.

Thought she'd tell me to stop being lame and just go fucking study for freaking math but NO! She actually told me to just drop it and if I can't find any sub, just do my stupid CDS next sem.

So touched I'm about to cry.

*melodramatic tears*

Okay, 9AM tutorial tomorrow. Officially meeting my classmates for the first time! Excited!!!

Should really pack up and sleep. Long day ahead. Gotta visit my grandmama in the hospital and collect my camera from my cousin and maybe, MAYBE replace YanYan @ work.

Pls pray appeal successful tmrw!

And that my new class is awesome.

Goodnight!

The best thing about me is you.

2011-04-14T15:49:00.000+08:00

HOLA IM BACK.

Wanted to do a post the other day but I was rushing out and everything delayed cus I was @ my class chalet! Speaking of which, I think Im damn efficient this time,

I JUST UPLOADED THE PICTURES!!!

*pats shoulder*

Anyway, some pictures from a while ago... 3 different occasions actually, so brace yourself for picture spammmm!

Went TeoHeng the other day with my ABC, my first time @ teoheng! Also got my katong chicken rice craving satisfied, teehee. (speaking of it makes me want it again >: )

Oh btw, Im considering if I should do my hair again this coming week.. cus my black roots are growing out super fast. Sad much, I haven't decided on the colour! Considering

1) Same colour

2) One shade brighter

3) Jet black + bangs (woah, china doll much?)

Oh god Im so fucking indecisive and I need to make appt etc. So fucking bz next week I wish I didn't book chalet!

Walau shit hell, should've just celebrated it @ Sean's dad's place!! Urgh totally regretted..

I was deciding between having a quiet nice meal with the girls and having a bigass celebration since its my 18th. But now both failed cus its neither quiet & private nor is it a bigass celebration.

#failedpartyplanner

Urgh, shall just let nature take its course, don't wna bother abt it anymore!

My first time @ TeoHeng lor! Unexpectedly hightech... and relatively cheap huh!

Terrorizing Sean..

Yups, then finished and headed to Peninsula to check my stupid Fisheye cus I lost my rented one. Le sigh, depressing much.

Ate @ pastamania @ Funan before heading back to the east to catch a movie.

I AM NUMBER FOUR!

As expected, mediocre storyline but awesome effect. Totally worth every cent of your money.

But the ride home was more epic cus we kept pretending to be the numbers and tweet each other if we're okay. HAHAHA CHILDISH PEOPLE R US.

And these, shisha with my colleagues!!!

Sigh, soooo much has changed since this outing. Depressing much. But at least we're still friends! :) Really didn't expect that I'd actually be hanging out with my colleagues cus I've always thought that it was just a job, nothing else.

But I haven't shisha-ed in ages and I actually choked on it. Lol #fail HAHAHAHA

But its a good thing cus I have no intentions of frequenting such places often again anyway.

Last batch of pictures. From somewhere ard end of dec last year. 4 damn months man.

This was after my trip to BKK. Rather impromptu cus it was only planned the night before/the next morning. Haha this silly guy came over to my school to fetch me after my psych project meeting.

Well, initial plan was to go to the railway to get some pretty shots but he had to go home early so we went somewhere near.

I STILL HAD MY PRETTY PEDICURE ON >:

SO SAD I MISS MY PRETTY NAILS. Feel so cheated now cus I just tried on this OPI Shatter which I got online. Fucking owner claimed that its authentic BUT IT ISN'T LOR NABEI IT DIDN'T SHATTER.

WHAT SHATTERED WAS MY HEART >:

Anyway, we were @ Changi and just strolled and chat and took random pictures. Quite happy with that day's shots? I mean not the best but not bad uh. Spent lots of time sitting by the beach to chat.

That day was also a very depressing day cus that stupid boy just got fired HAHAHAHAHHAH and I was talking about things I said I wouldn't talk about anymore.

But oh well, all's over.

Alright, time to pack and wash up, heading out in about an hour's time for work! Praying that it'd stop raining. Wa sian I feel damn tired now, hope I get enough sleep to night!

Oh right I should really stock up on my microwavable popcorn. So addictive!!!!

Lose to gain.

2011-04-07T02:06:00.000+08:00

Been wanting to do a proper post but I was so lazy to copy the codes over to blogger. Thanks to blogger's screwed up photo uploading shit, Im still on flickr. Not sure if the blogger's problem is fixed alr or not tho...

Anyhoo, Im blogging abt....

MY MAIDEN FISHING EXPERIENCE!!!!

Hahha as YJ corrected me, its not virgin, its maiden. Virgin sounds funnier tho...

Anyway, it was quite awhile ago uh! But was too lazy to get down to blog about it, along with a dozen other overdue posts.. Kuakua~

It was on a Thursday and I skipped school cus there's only 2 hrs of CDS and Im done with my presentation + test so it didn't really matter. Still wondering about what happened on that day tho!

Whooooo looking skinny here HAHAHAHHA

It was quite exciting but at the same time sian cus its really a test of your patience, its not as fast as prawning. Used life prawns + a little bit of worm as baits.

The worms were too iky to be used so we only used like 1 or 2.. Okay remembering it is grossing me out..

Camwhorecamwhorecamwhore while waiting. And I rmb playing Cheat!

Act one pro, like cast far only~

"Eh, where did it land to?"

Answer?

UP ON A TREE

HAHAHHA THIS GUY WIN SIA SRSLY!!

Can't remember if we eventually cut it off or it took us a while to get it down.

Couple playing "You jump I jump"

WHEE THE FIRST CATCH OF MY LIFE!!!!!!

HAHA SO EXCITING TO REEL IT UP!!!

It was a lil difficult tho hahhaa but the fish damn scary cus it looks like stone and is damn fugly.. It doesn't even look edible. And it looked like it had teeth and was struggling so I freaked out and dare not get near it.

You know what?

IT WAS THE ONLY CATCH FOR THE DAY

HAHAHAHAHHA

We r failz.

I think it died under the hot sun while we were trying to get the hook out of its mouth but to no avail, so some other dudes fishing nearby came over to help. They damn pro, caught a few edible fish! (well, those fishes looks more edible than ours!)

But the poor fish died anyway, and we were heading out after that, no one's going home so we threw it back into the sea eventually

What a waste, I thought someone was gna bring it home. If I knew it was gna go back to where it came from, I would've let it go ALIVE!!! WTF ITS DAMN SAD + WASTED >:

IT DIED FOR NTH!!!!

Minority photoshopped photos cus they looked rather decent.

Us being boliao. Taking picture of each other shooting each other. HAHAHA THAT SENTENCE DOESN'T EVEN MAKE SENSE. Wheeee matchy watch!

Waiting under the hot sun to head to DTE!!!

Wa super regret not wearing cardi and looking like a retard cus

I FUCKING GOT SUNBURNT.

LIKE SRSLY BURNT!!!

My skin was peeling, I look drunk the next day and I became like... 10 shades darker!!! (when the redness faded)

Kuakua~

The price to pay for not using sunblock... I think even till now I still look darker than I was! Sad max, really wna be as fair as before!!

Okay some irrelevant pictures, mostly from tumblr...

OMG THE NAILS ARE SO PRETTY I LOVE IT!!!

If only I can keep long nails and maintain all the pwetty jewels on my nails. You know me, they'll probably last less than 10hrs before the first piece of jewel eventually drops off >:

Seriously, Darren?

Its past 12, this marks the start of 7th April,

- Pay day!

- End of my 2 consecuitive off days

- 14 days till my 18th birthday!!!

Got a couple of movies in my laptop. Gna finish watching Scott Pilgrim for the 2nd time, watch "The Notebook" and "Juno" for the 2nd/3rd time..

But not today! So tired after a day of shopping chatting and noming. Will blog about it soon!

Time to hit the sacks!! G'night alllllllll!!!

When you walk away I count the steps that you take.

2011-04-04T02:30:00.000+08:00

Was totally suppose to blog a few days ago but I got distracted by tumblr and other mundane things.

Some happenings.

Well its THAT time of the month again and as usual, I picked a fight with the idiot.

Wa zzz I really cannot stand myself, like siao one, control alr in the end still go quarrel. If I'm him I alr cut off all ties with myself. HAHAHA! It doesn't really make sense but I really hate how I'm always treating him...

I mean, normally when I'm not PMS-ing I'll be fine and things will be great, but when I do, I just become some emo shit and just find all sorts of reasons to find faults and stuff and I'll wake up the next day to regret about it. Zzzz.

Anyway why am I so sleepy...

Maybe I should go sleep and just wake up early tmrw.. K g'night.

Bakebakebake.

2011-03-31T00:11:00.000+08:00

Today was super lazy day, headed down to salvation (like finally), down to the mall to grab some grocery and came home for some sorta bake-a-thon and disappointingly, nothing was nice :( caught 3 eps of GG + blog stalk & tumblr.

Mac N Chees half failed, bread pudding half failed. Well, looking at it from a more positive angle, this makes one success huh?

Officially 12AM, this means work's starting in 13hours. Oh how I dread.

Honestly speaking, this isn't the sort of mundane job that drives you crazy with all the rigidity and boredom, but what makes it so dreadful is the long hours of standing, smiling and serving customers even when you're having a really really bad day.

Sometimes I just really want to take a break or smth but I know I'll probably regret not having anything to do during the weekends cus currently its filled with work. Besides, if I can't handle this, what else can I handle?

Positive much?

Yup, trying my very best to keep things light hearted and wait for judgement day...

Anyway, all that GG is making me wish even harder and even more that Im away from sg. Move over to some angmoh country and take tons of photos.

Brought it up to both my mum and idiot before but sadly I'm nowhere near my dream.

Looking at them wear pretty dresses, attending parties make me hate myself even more. All the horrible thoughts in my head.. If * comes to know of it HE WILL KILL ME!!

Yawns, alright, time to do some planning and head to bed. Totally procrastinated the day away.

Looking forward to Sat!

Mandarin Oriental

2011-03-30T03:59:00.001+08:00

This was pretty recent... around the IT fair period?

Some impromptu stay @ Mandarin Oriental hotel cus we only started making plans like 1-2 nights before the actual day and my mum kinda didn't inform me early bout it. It was pretty convenient getting there anyway, just a lil tiring since its right behind Marina Sq.

The whole hotel just gives you a very resort kinda feeling with all the decorations and ambience around.

Even their toiletries are so....spa like!

Was feeling super tired and sooo tempted to go for a massage but its fucking $1xx!! I can get 10 massages in bkk with that amount man... So I just lazed around and took long hot baths in the end since they provided bathing salt.

Me likey their pool side!

So relaxing with all the beds and sofa.. Hmm wouldn't mind going back again!

Anyhow, got Macs back to the hotel as our dinz while watching "Scott Pilgrim VS the world". Awesome only if my laptop's sound system didn't suck :(

Also caught "The Hangover" which was damnnn hilarious! I think only cus it was the uncensored version. How boring would it be if it was censored?!

Wanted to play monopoly but we didn't. Just uno and lazing around, taking photos. But it was still fun anyway since its been a while since I last spent some time with the girls.

Work drained my weekends and every single bit of my energy.

Moreover LF was busy studying for her exams.

Just watched TV and used my laptop before heading to bed. The best part about hotels besides the awesome facilities, comfy bed, clean white sheets, 24hr airconditioning, room service etc, is the house keeping!!

The shiokness of messing up and dirtying the place and having someone to clear up after you. No wiping, no vacuming, no sweeping, no making of bed, NOTHING!

Went for breakfast @ the hotel the next morning before packing up and checking out. Express check-out is also damn awesome since we have no bill to clear thanks to my mum's pre-deposited value for our room, heh.

The next day:

WATM > IT Fair > Work

IT Fair was madass squeezy! If it weren't for my memory card and mouse I wouldn't have bothered bleh.

Getting a lil sleepy now. Need to make a trip down to salvation army tomorrow. Kar hasn't replied me :( Might be catching an ep or two of GG/play sims or just sleep. Feeling like bakinggggggggg tomorrow!

And I'm sorry I made you worry.

Time alone.

2011-03-29T17:58:00.001+08:00

Was feeling down since.... Thursday? Cus so many thing's going on but I feel a lil better already. Kinda made up my mind that if it isn't gna go the way I want then it isn;t. No point crying over spilt milk.

1) Suck it up continue

2) Give up and leave

Waiting till the end of the week till I make my choice... So yup, gna just face everything normally till then.

And yup, idiot texted me bout it. Sooner than I expected tho. Haha and I thought it'd come as a mail or something. But yeah I haven't been really nice cus I avoided him for a full 3 days+ before I replied him.

Just needed time to be alone, think it thru and not be so attached anymore. But most importantly cus I didn't understand what was going on so I really didn't want to bother repeating my story over and over again.

K time to leave home and meet JJ. Been ages since I met that girl! Gna have dinz tgt and she's coming over!!

Bye!

P.S/ Above mentioned problem has nothing to do with my r/ship or anything, tyvm.

Last Sem.

2011-03-28T00:27:00.001+08:00

HOLA! Photos from last sem, unofficial last day, last presentation if I'm not wrong.. Also the only official presentation we had to do for the semester.

And these, were from the official last day of my poly year one. Its always so sad to think of it yet ironically, it was our last paper. Pretty damn glad that I managed to finish my mkt paper within the time limit and I had a good feeling bout it.

Nom-ed at Popeyes before heading off to meet YJ for a littttttle while. I think cus my plans with my classmates screwed up haha.

Had to get a makeshift dress from stupid Bugis St and the cb dress was so fucking short... Its damn irritating!!

Their caramel milk super awesome I tell you! So is the food!!!

And then off to meet Kar.. Walau super busy day ah me. But that stupid girl wanted to go bugis for her dinner so I went back again. Stupid adult fare was so expensive I really felt the pinch man, ouch.

Exam > TM > Bugis > Tiong Bahru (collect smth) > Bugis (again) > Pasir ris

Haha and then met that idiot (intentionally) and the 3 of us sat and chillax at White Sands Mac for a little while. So awkward but thank god both of them are not shy.

But someone has presentation the next day so we called it a night at 11+. Also to catch my last bus since he took public transport as well.

------------------------------------------------------------------------

Some more pictures from some other random night. 15 Jan I remember because thats my cousin's ROM! Headed out and went to meet Kar (again, HAHA) after the whole thing cus idiot had to go out of town so we cancelled our plans.

Initial plan was to go Clinic but there came an invitation to Stereolab. But since we JUST got to Clark Quay, lazy bum didn't want to cab here and there anymore.

So...peh, there we are, drinking along the riverside of CQ with this girl sleeping (wtf she actually slept and made me talk to myself, nabei)

Heh but idiot texted after he came back to sg. But my phone was outta batt while we talked halfway and I think that kinda worried him cus he texted again first thing in the morning. Pretty damn rare given that we don't really text much.

Oooh, and prior to that, we found a pack of ciggs inside the lift of Ion! Hahahha fucking lucky I tell you cus she wanted to get a pack but I didn't want to start smoking again so we were contemplating and viola!

MIRACLES DO HAPPEN!!

Haha but I felt kinda bad cus I had a stick + drinks, smth I promised I wouldn't do. So anyway its been 2+mths since I last touched any ciggs so... yay me!

Oh god, soooo many things happening at home, everyone's PMS-ing and so am I.

Stupid weight problem, stupid money problem, stupid many things to worry about.

StupidStupidStupid urgh!!!

Gna take a shower and head on to bed soon, < 6hrs to sleep! Gna be a busy week, so much to planning to do tmrw. Hope that it'll take my mind off food!! Minimal eating tmrw!!!!

G'night.

2011-03-27T01:54:00.001+08:00

"It hurts to love someone when we can’t tell them what we really feel because sometimes we get hurt without them knowing. We get jealous even if we have no right to feel that way. We want their time even if we are not in the position to demand for it. Although our hearts are breaking in silence, we still continue to love them because somehow in this hurtful love there is still hope of having simple moments with them even if it means being just a friend."

So tired I don't know what to think or do anymore.

My weight's been fluctuating like mad, me iz sad :( But I've got so much cravings to satisfy!! :( Really feel like getting popcorn, fish&co, astons, botak jones, porridge, fish soup, macs, pizza, mac&cheese, etcetcetc wtf

Watching GG/heading to bed now. Ending work early tmrw hope Kar meets me, g'night.

Gossip Girl

2011-03-24T05:37:00.002+08:00

Just read idiot's email, huahua we are damn qb and lame. The stupid things I say to him and he says back, I think I really asked for it myself man.

Went prawning today yay! Fucking finally!

And guess who finally got her white top + Gossip Girl S1 on her laptop!

Wheeeeee, gna have lunch with momma @ Mandarin Gallery later before work.

Sho happieszx, gna check out some stuff and head to bed. Pffftt, I kept waking up and sleeping again and again. Zzz alright, toodles!

Christmas 2010

2011-03-23T03:43:00.001+08:00

Some photos from X'mas. More like X'mas eve tho.

Anyhoo, met the girls on Xmas eve! Heh so happy! I think I rmb 2009 we had steamboat at my house or smth... Didn't bring my instax tho!

Im always caught as to which cam(s) to bring cus they are alllll sooooo bloody heavy.

Hmm met LF early to have lunch @ Sugar Granny Cafe!

5 Teo Hong Road

Near outram MRT

Its a litttttle bit of a distance to walk cus we went a big round after exiting from the wrong way from the MRT station.

Quite a limited choice uh, but their deboned chicken wing is damn awesome cus its FUCKING DE-BONED HAHAHAHHAHAHAHA! Super easy and convenient to eat! Plus, I think its the nicest there... Hahah. Caution: The chilli is motherfucking spicy!

(Y)

Look a lil cui leh me. But I love my minnie ear! Got it from BKK if Im not wrong. And my ring also heh. My face looks so matt that day. But I think I was sick/didn't have enough sleep actually.

The design @ the cafe was pretty nice tho. Haha like some olden shanghai cafe or something.

Outfit for the day!

Looks a lil awkward tho.... Stupid heels are chioer IRL.

Damn awkward taking pictures cus this was @ outside GongCha Orchard Central and I noticed that the sales people like laughing/talking about us. HAHA PAISEH MAX!

Anyway, after lunch we went to meet YJ and walked ard town. Shopped for xmas gifts, which is chocolate for everyone, and had din dins before sitting outside GC for the rest of the night spamming photos.

Sigh, miss my pretty nails.......................... :(

AHAHA THEY SO QT AH!

She's a genie but she can't grant you your wish. (Okay this makes her pretty useless HAHA)

HAHA MY MOUTH HERE DAMN QB... Its so fucking.... slanted? HAHA :/ indeed.

I look weird.

K anyway the pictures are really jumbled up.

Drama day as well. Cus my brother just came back from Japan and the airline fucking lost his luggage (which was then later recovered) and I didn't meet idiot cus ... idk, I think I'll just say its fated that we didn't meet or spend Xmas tgt.

Haha oh well, there's always this year's right.

Went to work the very next day.

Work on X'mas day, how sad, and I don't even get paid extra! Hahaha but yeah I left my house in a hurry and forgot to bring my santa hat clip >: So I can't wear it at work :( :( :(

I think I did cashier the whole day and it was fun wishing people Merry Christmas. So joyous. HAHAHA

Soooo long ago when flannel was allowed and when Fifa and Gab were working.

Le sigh.

Anyway, think I did cashier on New Year's Day as well. Haha also got to wish people Happy New Year, hiak hiak.

Okay, its like freaking 3.30AM right now. DL-ing my GG season 1, like fucking finally.

Might be heading to bed soon, idiot's asking me to go to bed! Gna chat with Juan for a lil while more and hit the sacks! Hafta wake up early to get some stuff tomorrow. Heh toodles!

NYE

2011-03-21T02:35:00.001+08:00

Finally getting my ass down to blog about new year's eve. Yup, 2++ months ago.

Not gna touch on it much since its alr 1.40AM and I wna wake up early tmrw to exercise. Sad me been eating a lotttt recently. Walau really must hardcore diet and lose like 1-2kg per week like I use to :(

Anyway, it wasn't really a happy new year's eve since I was working, plus, a couple of my friends/colleagues left :( Sad, that was like the "mass resignation" period man.

K but I was wearing my then-fave flannel shirt. Haha oh, how I use to rave about it everytime. Now I couldn't be arsed to touch it cus I'm not allowed to wear fall/winter products anymore, PFFFT.

HAHHAA IM SO SHORT I LOOK LIKE IM FLOATING IN MID AIR HAHAHA WTF WTF WTF!

My plan was either work friends/poly friends so I figured it'll be more convenient to leave together with people Im working with.

Nom-ed, took photos, lepak and went back to Somerset to meet some other people.

Problems here, problems there, problems unsolved

Stranded @ Somerset MRT for countdown

Yup, nearly cried I tell you. Fucking stupid y'know we "counted down" in the train station where it was like... dead. No one had the new year spirit. And for that while I pretty much regretted not going out with my poly friends.

Feel like punching myself in the face for getting caught in that kinda loser-ish situation. Of course there were a whole bunch of us so it wasn't really that much of an embarrassement. It nearly looked like we planned it tho I must say.

Initial plan was to head to Marina Barrage to catch the fireworks + countdown but we only managed to jostle with the crowd after we entered 2011 at Boat Quay zzz. We were walking in complete opposite direction as majority lor!

It honestly wasn't as bad as Im making it sound lah.

But you know me, whine whine whine, complain complain complain.

But once you get over the fact that it was loser-ish and starting thinking that you're gna remember this for the rest of your life, things just kinda get better.

Found a spot by the river and started drinking.

Now thats when it all starts.

DRUNK.

HAHAHA AS USUAL LIKE THE PREVIOUS YEAR. ONLY CLARK QUAY BECOMES BOAT QUAY.

Really don't know what I was doing. Like

4 X RedBull + Vodka = GONE

Win. I started out pretending to be high so I wouldn't feel so angsty. But guess who got too engrossed into it?

My defence? Sorry lah, lao niang sick period + work that day, body tired right...

Still at the first cup.
Going....

Going....

Going.....

Err... Going.......

Going.....

Going....

AHAH GOING.....

GONE.

WASTED SHIT.

Photo-bombing people, hugging people's boyfriend, jumping around, screaming, shouting, laughing, singing...

Can hardly remember wtf I did or said. I just remember shouting a lot of "UH UH SIOL" like some stupid minah wannabe......... zzz

Hands all over people I shouldn't be touching, force-puking in full view of strangers, sleeping by the roadside, shouting at my friends to get my stuff, drunk-dialling Karmaine and one of our conversation went:

Me "Hello hurhurhur okay okay I'm sober... *puke*"

I remember lying on the floor and slamming my watch against the concrete surface whilst helplessly mumbling to myself saying "My watch...."

My poor 1 month old (or less) Fossil baby got cracked just like that. Scratch proof got smashed. Awesome.

I have no idea what were we looking at. Normal on the outside but seriously screwed on the inside.

I was eating fries somehow and made my friend feed me more (FEED ME, RARRR) and when he did, I fucking shouted at him for feeding me cus I became really queasy and started to puke.

And I proceeded to talk about very stupid things to his girlfriend to the extent where I have to be pulled away.

So I managed to get home, confess to my mum that Im drunk before turning in for the night. Amazingly got up for work with no hangover. Sole survivor of our group cus there were like 17 people on MC on new years day.

Saw like one million scandalous photos. Oh the inappropriate things I do when Im drunk. Tsk.

And of course, spent the rest of the day... or rather, week, apologising to everybody whom I was a nuisance to.

Note to self: Never ever ever EVER let history repeat itself.

Anyway, full album here!

Cuz baby tonight the DJ got us falling in love again

2011-03-18T22:01:00.000+08:00

Meh, sucha lazy day today.

Fridays were meant to be gym days but I couldn't get my ass down to text YJ. Wanted to head to salvation + do some cleaning up of my wardrobe but nahhhhhhh.

Had Ice Cream Chef with Sherina + got my cheekin rice (hahah my cravings fucking annoying) and played some sims. And I just woke up from my nap, yawnnnnnzzzzz.

Feel so lazy to do anything, just wanna nua at home everyday...

Okay time to do some photo editing and uploading!

Is it me or have I posted this before? Anyway <3 this pic!

BADMINTON!

2011-03-17T02:03:00.000+08:00

My photo albums are all rather jumbled up so Im gna update y'all with what happened today instead of trying to follow back with what I ended with. Man I really need to make a list of the albums I owe/have to create on fb etc.

So yup, today was rather okay. Most of the things went well but idk I feel kinda frustrated with myself at the end of the day. Its like the feeling of loneliness and saddness starting to creep up on me >:

Plus the weird dream about running around in my dream.. We all know what does running in your dream means. Urgh, so do not want to think about it!!!

Okay anyhoo back to topic!

Today was sucha sports day for me! Kinda got a lil messed up the night before cus I thought it was kinda cocked up with "invitations" from both sides but Im pretty glad things worked out just fine in the end!

Ran some errands in the morning and did some chores and I ended up late! Heh but all is forgiven!

Heh queueing for GongCha!

Mad love GC's Melon Milk Tea!! Wins Koi hands down (but I wouldn't mind if someone was willing to queue Koi for me! HEH HEH)

Walked around, got an awesome top at < half the price. Met the rest and headed to pasar malam for dindins! Ooooooh, love street food!

Sad me, the corn wasn't sweet :( But its okay cus had a pretty nice time just chillaxing at the void deck.

And then.....

I WENT HOME AND CAMWHORED!!!!

Haha super love the dress Im wearing! Just collected it today at the PostOffice. Wore a dress cus I thought I was meeting Kar but that stupid girl said it'd be late. Gave up and just went home.

Btw, finally caught Mean Girls 2!

I honestly feel that the movie isn't bad y'know!

K tho some parts are like a lil predictable but some parts are different from the first movie! Tho the biggest difference would be that the actors/actresses are less hot in this movie? Think comparing the male leads, Aaron is better looking than Tyler.

Oh oh oh! But I think the lead actress Meaghan Martin is madass skinny!!! Omg go see when she wears jeans + the checked shirt. WOULD TOTALLY DIE TO BE THAT SKINNY OMG!!

K I sound stupid zzz.

Some FB alert spam while going thru my pictures. This could only mean that QY is at work - tagging us on FB.

My mum was being lame and asked why am I home so early when she called at ard 8+PM.

8+, very early meh?

Okay maybe it is cus its my off day afterall and she knows who am I meeting.

Anytime before 10 is probably considered early since Im normally home at 12+/1+AM. Partly cus I take a long time to travel home from town/DTE if I bus, and also cus sometimes I have someone to send me home so no worries about transport.

K Im so tired now. Been so long since I last played Sims, maybe I should just stay home to rest on Friday...

Maybe.

Mandarin Oriental

2011-03-13T01:17:00.000+08:00

Meh, currently @ Mandarin Oriental now, staying over for the night.

Heh, I love hotel stays cus I always get to take nice long hot bath and drink some hot drink before I sleep. The bed and pillow is super soft and fluffy as well! Of course the best part is not having to clean up after myself, ho ho ho!

But right now my shoulders are aching like mad uh >:

Photo from the poolside just now:

Just a mini upload, not the full album of course! And the photo was obviously photoshopped!

K looking forward to breakkie tmrw, heh, shall chat a while more and turn in soon, g'night people!

You got me thinking.

2011-03-11T11:29:00.001+08:00

You always seem to have some kind of power to make everything better.

At times we find ourselves waiting for each other's answers but at the end of the day you always give in to me, you always do. Despite all my tantrums, you're still willing to pretend that nothing ever happened and try to work things out properly, all over again.

I wish that I'd stop doing all these mean things to you. No, I want to. I want to make all of this stop cus playing with fire is never good and you'll never know when you'll get hurt.

But I also wish that you'll stop throwing stupid questions at me cus you know I'll give you an answer that satisfies the other person yet hurt myself. My answer wasn't wrong, I really didn't mind, but you should learn when to stop or when to say no.

Shit always happens, but you know what?

I'm glad I met you. And thats all that matters.

Meh, suppose to meet YJ at 12 but Im soooooo tired and cannot get my lazy bum off my chair :(

2011-03-08T00:25:00.000+08:00

怎么办，开始觉得越来越喜欢你了。

我不要

因为以后你走了我怎么办？

Uniqlones go JB!!

2011-03-06T10:54:00.000+08:00

Finally, pictures from a million years ago.

Yup, finally got the time(and get my lazy ass down to it) to upload the pictures.

Anyhoo, I can't rmb when did I last enter JB. Super not the M'sia kinda person! Haha so I was quite sua ku uh.

Didn't sleep the night before plus I was sick so I was like sian the whole day :( Like dizzy, light headed and totally didn't have the mood for anything :( Super wasted but yay I'm going there again soon!

Noms at Kenny Roger, but the food sucked, peh. Haha, and all the food there is soooo cheap!! We had some eat-a-thon man.. The Secret Recipe there is sooooo cheap!!!

Its like same price as Singapore, but IN RM!!!!!

*GASP*

So if its SGD$5.5, its RM 5.5, YOU KNOW HOW CHEAP IS IT????

*HYPERVENTILATES*

Whoooooopie, can't wait to head down there again to spam all the cheap food and buy all my bimbo things! This time, I better be well alr!

Btw, caught Little Fockers there and I totally dozed off during the movie luh! But it was on off dozing off lah hahaha. Oh and I don't even think this sequence is funny.. meh. Maybe its just cus Im tired..

Took the train back to sg, as usual, sua ku me screamed when the train suddenly moved.

Kuakua~

And slept otw homeeeee.

Craving for this now omgggg!

Oh btw, had this weird dream that Kar was some bartender and I went to have a drink. Had 4 drinks or smth and it came up to be $6k++++ HAHAHHA WTF and that cheebye refuse to account as spillage and treat me LOL OMG...

Okay, gtg, laptop's outta batt, bye!!

First day of holidays.

2011-03-04T11:34:00.000+08:00

Yup, the smell of freedom. Smells like morning air with the grass cutter without a hinge of worries or stress. Me likey. (okay that long descriptive sentence didn't make sense. Was just trying to be...poetic, meh.)

Did some sorting out to my albums, uploaded my pictures (into my laptop) and some onto flickr. Shall post em up soon! And some other batchs of photos to be photoshopppppppeeeddddzzzzzz....

Gyming plan major #fail cus I was so lazy to go over to Waiwai's house and she's lazy to exercise too. Meh, we are so unmotivated. But anyhoo, I am like whut, 2kg ligher (from lsat night before I slept). Yup, mind fucked alright, but hey THATS AWESOME HAHAHA.

The 3rd day of march went well for me, keeping my fingers crossed that today will rock too.

Heh, wearing my straw hat out, kbai!

Wa sibei hungry.. Craving for jap food again!!!

Don't say it if you don't mean it.

2011-03-02T18:21:00.001+08:00

Howdy matey! Tomorrow marks my last paper, also the official last day of Year 1 of my poly life!

So far all my papers have been disappointing, maybe because I place high hopes on them. Guess its really true, the higher the expectations the greater the disappointment.

But I'll just live with it cus life goes on, good or bad, happy or sad, might as well make the best out of things right?

And mainly cus people around me have been supportive, especially my mum and that idiot. My mum especially! You have no idea how many SMS she sent to tell me to take it easy and don't overstress myself.

Anyhoo, really have no mood for marketing.. Feel like just scribbling any-o-how and leave the room. Currently very fucking cash tight... I'm suppose to be excited since my pay's coming in approx 5 days time!

But I took study break so... yeah. Pffttt. Im hoping it will be maybe $6xx? Pretty please? :(

AND THIS!

Contemplating if I should get em... I'll have to flip thru the wholeee of my link just to track them again. Urgh, so many things I wna get right now... Really wish my mum can gimme $1xxx from her bonus... Then I'll be mad happy.

Main problem now is if I should rent a camera... $70+ in total?
>:
Heartache much?

Promise a real update soon! Gna finally edit my pictures and upload them!
Sometimes I just feel like my blog is so dead I don't feel like bothering about it anymore. Boohoo.

Oh, just changed my blog banner btw, heh. Should I stick to the prev one or change ot this? Lemme know! Looks so awkwardly short right now!

BStats.

2011-02-28T13:55:00.000+08:00

Comfy tee, check.
Unmade bed, check.
Furry pet sleeping right beside, check.
B&J's, check.

Tumblr a lil and take a nice nap before waking up to own POM. But stats was horrible, kthxbai.

Motivation.

2011-02-27T14:59:00.000+08:00

No such word in my dictionary right now.

I mean, yeah things are still going pretty well in my life but I just really cannot find my motivation to study this time round. I don't know how the fuck did I manage to study so hard previously but now I just feel like.... crap.

Just plain useless crap.

My weight is like the inflation rate, going higher, never lower. I gained a whooping 4kg (from my lowest weight) now I don't even dare think about ordering things online..

Okay I lied. I just did. I think my bank officially has 2 digits right now. First time in history ever since Im on my own allowance. Just really praying that March 7th comes soon and my pay will at least be $6xx.

I just kept running away from things and eat non-stop and then I'll just go and force myself to puke it all out. I know theres a term for it, its called bullimic and tbh, Im not getting out of it. Not anytime soon so just leave me as I am...

Yup, but despite being stress and all, I still manage to camwhore. Teehee.

Gna look like this in school for the next few days:

DORK!!!!

afbuewhfoihwgfbugwefjkvbjkfenv very stressed!!!!

Stressed abt exams,

Stressed abt money,

Stressed abt my weight,

Stressed abt my 18th birthday!!!

And its been damn long since I went to work, starting to miss it.

Im so sick for missing work, yuck. But yeah, couple of things happened and a part of me just feel like disappearing and never see them ever again. But the other part of me wants to just go to work and slog my guts out to earn $$.

But if I do, I won't have time for my friends!!!

Mofo. Urgh cannot stand myself, fickle as always.

Anyway, been wanting to wear this tee for a long time but its fucking unflattering. Not giving a damn now cus I gained weight so Im just a lump of fats waiting to be judge, peh.

Omg I sound awfully depressed don't I... Nah, it will past, soon. Not that soon, but yeah soon.

我爱世界

Bye

(Not)Fated.

2011-02-26T03:47:00.000+08:00

One paper down, 4 more to go!

Econs was rather okay, so my 11:11 wish did come true. But alas, downside to an easy paper?

Moderfuckingration.

Yup, not very favourable to me especially when I made 1 million careless mistakes and maybe 1million & 1 stupid mistakes.

Today.. was pretty mindfucking yet at the same time hilarious.

Today was also the day I spent a bomb on dinner despite being broke (yup, eat somemore lor, die fat, ugly and poor). Still refusing to ask my mum for help. Previously she shoved about $50 on 3 different occasions and that, I am going to pay her.

But I just spent the last 2hrs+++ shopping online. A whole load of things to buy, definitely not within my reach, unless I can uh Bank Overdraft ah? Haha, no I'm totally kidding. Shit me what will happen if I have my own card urgh.

Well, I mean currently I only have about $50+ worth of items to be checked out and it'll still leave my bank with a 3 digit figure.... But gna go out for celebration next week, pay isn't coming in till 7th, 4 days after my last paper, how the fuck am I gna survive?!

This is pretty damn irrelevant but yup, just a picture to make it look less empty, heh. Okay shall decide if I should:
1) Order stuff and sleep
2) Order stuff and do stats
3) Order stuff and help mop the floor at fucking 4am

Feeling rather hyped up right now... Should be due to the Earl Grey Milk Tea my mum got for me from GongCha. Mad love *slurps*

Okay, time to go!
Its still feb, I'm still basking in my own joy.

Shall refrain from coming online for the next 6 days.
Go me go.

Goodnight :))))

Productivity.

2011-02-22T02:38:00.000+08:00

Shall try my best to keep this space alive by updating once every while... Guess for the next 2 weeks its mostly gna be grainy webcam pics and updates on my studies (or procrastination).

Today sucked. Big time. Cus I was fucking unproductive and barely finished 2 chapters of accounting. FML max really cannot stand myself sometimes.

The worst part was that I was the distraction, I wasn't being distracted!!!

Currently in my PJs, still online shopping and chatting. Le sigh, really really lagging behind in all my studies. But I just can't seem to find the motivation to study leh?!

I mean.. Yeah I just feel like I will just die of saddness if I dont score the same as/better than my previous sem GPA, thats why Im not really bothered to try hard cus Im afraid of the failure.. >:

Thats just damn stupid thinking.. To not even want to try out in the first place, urgh. Stupid me better get back up on my feet by tomorrow morning. Tomorrow better be productive for me!!! I've got not much time left!!!

Anyway, things have more or less fallen back into place, non-academic wise. Haha, not really the best time for such stuff huh. But still feeling pretty glad that that idiot is so understanding.

Sigh, sometimes really want to punch myself in the face if I can.

Alright, time to finish up as much as I can right now!

TOMORROW WILL BE A BETTER DAY,
g'night!
xo

2011-02-19T01:11:00.000+08:00

Just so you know, its tough, and its just going to get tougher cus my insecurity and pettiness would destroy it all.

But you should also know, Ive never been happier having you around, never stopped thanking feburary for being so awesome and never ceased wishing or praying for the better.

Thank you for being there,
goodbye and goodnight
xoxo

Tumblr updates

2011-02-18T01:19:00.000+08:00

Glad to finally say,

MASSIVE UPDATE ON MY TUMBLR!

Sorry I was sucha schmuck today. God, sometimes I think I am such an asshole.

Goodnight
xoxo

Cus in my dreams, I see you again.

2011-02-17T01:17:00.000+08:00

How time flies, its alr the last day of CNY! Giving school a miss today cus I really cannot be bothered to go for my CDS for just 2hrs. Gna go fishing with some of my friends tho, heh, first time, eggcited much!

Yups anyway, some pictures of Nini's "CNY outfit". Haha the mad bimbo dress I got her! She looks so qt in it!

Been looking like a teddy bear lately (not this set of photos!)

AIYOH SO CUTE, HOW TO RESIST!?!??!

---------------------------------------------------------------------

Suddenly realise that so many things have happened within the span of 1 year. Feels like nothing's the same anymore yet at the same time, it feels like nothing has changed. I don't know, its so complicated and scary how different everything is right now but we're gna pretend that nothing took place.

Okay shouldn't think too much cus nature will take its course.

Anyway, heh cannot stop emphasizing how well life's been treating me. Pls just stay this way, I promise I will be good and exercise and eat tons of vege and do my work and score well for exams but I really like how things are right now!

Yups, today shall be my last day and I shall turn on my study mode and work really hard cus its just 2 more weeks left!!!

Okay feeling damn full. Gna text people and go to bed alr! Buh bye!

Valentines day.

2011-02-15T01:31:00.000+08:00

I can haz many presents!

I really really truly honestly sincerely appreciate each and every one of the presents! Flowers, bears, chocolates, hearts, lollipops and stuff!

Baked chocopots and brownies this year for the people ard me hom nom nom :D

Of course I didn't get an actual confession or anything like that! Hahah sad uh I've always wished that it'd be like in the drama where the girl and her friends are walking and this guy just dashes out and thrust a beautifully wrapped box of chocolates or bouquet of flowers to her.

HAHAHAHA SORRY FUCKING DRAMA UH!

But anyhow, the day ended on a nice note with what I shall assume as my first vday's date ever! Haha yup, just me and that guy, under the night sky, tho its unofficial and unrecognised, hehhhh.

Here's some virtual love to you! I love my friends so much :)

P.S/ Sorry this post is so unsincere, Im so tired my initial plan was to sleep at 7pm + but look at the time now!!! >;(

Yawns.

2011-02-13T03:23:00.000+08:00

Whoopie! Feeling kinda happy now cus I'm done with my CDS!! I mean studying Psychology has been fun and all but it does get a lil tiring. I think mainly cus I actually did some serious last minute work and thats why my brain wouldn't absorb things properly.

I barely had 7hrs of sleep in the past... 64HOURS!!!! WTF MAX CAN?! And I'm starting work @ 8AM tomorrow urgh kill me already. Wtf gna look so cui tomorrow

Sigh, and Im gna sleep late/wake up early on Monday... and then there's 9AM class on Tues... Major lack of sleep alert!!!

So anyway, after my paper today I went to meet the girls... After so long!

So now I can proudly say....

WELCOME LF TO THE APPLE FAMILY!!!!

Haha okay good, so I can officially spam her and not wait for such a long time for her reply!

Caught a movie and lepak around Macs before heading off for work.

Oh btw, caught The Green Honet! EH REALLY NOT BAD LEH QUITE NICE WHY THE RATINGS NOT GOOD AH?

But anyhow, if you ask me then I think its really worth watching! Can laugh at Jay Chou's english anyway HAHAHAH!

And this weekend's gna be awesome cus we're finally done for projects this semester/year! Yeah its kinda like a sad/happy thing but at least its happy for now cus we're still gna meet up and stay as friends next time!

:DDD

Yups, in a super good mood now heh. Feb has proven to be awesome so far and in less than 24hrs time its gna be Valentine's Day! Lonelygal1993 has no date but fret not, its also NiNi's birthday!

Hahaha omg I can always use her as an excuse!

But no lah just kidding, I'll prolly be spending it with my poly mates anyway since I've got lectures till... 6pm. Kua kua~~

Haha okay shall just finish up what Im online for and head to bed! Gna sleep for less than 3hrs only. Sad me, bye.

2011-02-07T01:41:00.000+08:00

I'M SORRY I LIED AND DIDN'T UPDATE.

LOL.

MBS

2011-02-03T14:18:00.000+08:00

So much for updating regularly huh?

*BURPS*

Sorry, been having very very full meals recently.

Feb's been treating me well so far, hence the lack of update, sowwie!!! :(

Sigh, sometimes I really don't feel like continuing this blog. I mean I have pictures, but most of the time I'm just too damn lazy to upload them cus of the photo limit thing! Or is it okay already???

So anyhoo, quite sometime ago I managed to get a room stay @ Marina Bay Sands Hotel. It wasn't exactly free but my mum gave it to me anyway. Wanted to celebrate the december babies' birthday there but they all pangseh and don't want to come!!!!

So it ended up with only LF, Hanis and I. Pathetic much, but it was kinda like nice cus we just chilled and watch movie/tv and slept. Comfy bed!!!

Managed to get one of the higher level ones, uhm 47th floor? Likea shiok right the view from my room!

We had kfc + this small cake cus there's only 3 of us :(

The bathroom is huge!!! Me likey! I took 2 bath within the span of 30++ hrs there! Hahaha damn shiok!

My face damn white -.-

So we had cereal the next day. Just munched and talk + tv. Sneaked up to the infinity pool while the other 2 were still asleep.

Met YJ to watch Easy A and shop around. LF "lost" my laptop and we had like a major panic attack!!! Thank god it was recovered. Pfffttttt!!!

EASY A IS A NICE MOVIE, GO WATCH IT!!!!

FULL ALBUM HERE! Mostly pictures of me only.

Okay! Time to go! Needa make up and stuff, my mum's rushing me alr!!! I'll blog a more CNY post later/soon!!! PROMISEEEEE!!

HAPPY CNY Y'ALL!!!!!

Project Submissions.

2011-01-27T04:43:00.001+08:00

Bear with me, the many project submissions are nearing and trust me, I'm a lot more stressed than I seem.

Looking on the bright side, things will be better on 1st Feb, well at least thats what I'm hoping for. Keeping my fingers crossed please!

Today marks the 17th year you're gone. Imy and I hope you're happy wherever you are.

Monday blues.

2011-01-24T14:02:00.000+08:00

Its a Monday, I'm in school,

in my slouchy cardigan and specs.

Woke up late, really late, I didn't like it.

Yesterday was kinda rough for me, today was a bad start to the week.

Keeping my fingers crossed that tomorrow will be a better day.

Its like, I'm not even fully stressed out or anything, so why am I behaving like that.

Skipped lecture to finish up my work, I should really get started.
Ih8myself,
kthxbai.

2011-01-24T02:59:00.002+08:00

I WANT TO BE HAPPY.

I like guys who smell good.

2011-01-21T03:25:00.000+08:00

“Love is when a girl puts on perfume and a boy puts on shaving cologne and they go out and smell each other.” - Karl, age 5

“Love is when you go out to eat and give somebody most of your French fries without making them give you any of theirs.” - Chrissy, age 6

Imma happy girl :3
Goodnight people, time to do my work! :)

Project day

2011-01-18T14:07:00.000+08:00

Today's gna be a long day :(

Should I collect my jeans today???

Tired

2011-01-17T18:35:00.002+08:00

Feeling really tired right now, so glad that I didn't go for the intended Psych lec! Was dozing off all the way. Blame me and my procrastination! Slept at like 5am and woke up at 9ish, who can take it?!

Yups, but I skipped 1 lec and totally slept in the other so I might as well just not go uh.

Very upset now cus I've been eating a lot lately... Praying that its just my period!

Anyhoo, pictures! This new bag I got from TS! Sh0 hApPi3! Its really convenient to carry ard cus its big AND STEADY!

Heh, plus my qt jap doll tag! Mad love. And my nail is of a matchy shade as my dress!

Hmmm, I was being an itchy hand and cut my fringe on my own this morning :( Totally misgauged and snipped it a lil too much now I look like some sua ku. Its not THAT bad, think it'll look just fine by the time CNY comes.

Excited for CNY! Goodies, ang pow, new clothes and my red hairrrrrr! Prolly the last time Im doing red before I switch to another colour, I've got plans already!

Gna go wash up maybe take a bath and have din din now before I get started on my long "To-Do List"! Think Chewy was the only one who saw it (besides my mum) and I think it shocked her.

I can't help it! I just like to make long long long lists and strike the item off one by one and just sleep when my head hits the pillow. Workaholic much, but its better than laying in bed and thinking about stuff and fantasizing about a future thats never gunna happen.

K time to go! Shall not use the internet for personal matters until I cleared at least half my TDL!

Oh before I leave, praying that my hugeass pimple/mark/scar (pls not) heals before CNY, so ugly now, shall not apply anything else except eyeliner tmrw!

xoxo

Blah

2011-01-14T11:47:00.000+08:00

Am alone in the library cus the rest are @ Pizza Hut celebrating D's birthday. Le sigh, lonelygal1993. Really wish I can join them but I've got the psych research to participate in and its my last one! Makes no sense to just forsake it right!

Normally I'd be happy/fine with doing stuff alone. I mean, what better time than now to catch up right? But urgh I've been feeling soooooo angsty these few days.

Like I just want to burst out crying or punch somebody or eat eat eat eat eat non-stop and choke on all the desserts and sweet stuff.

I think my period's coming :(

Sometimes I just feel so... irritated with myself. I mean, look at me, I'm a mess! Huge mess. Maybe not to others but deep within I just feel like I'm not me anymore.

And it kinda sucks to miss your old true self cus sometimes I wonder if I've changed for the better or for the worse.

aihfijewivjregnioehwdcxjsdjfeowpqhnwqevfenwihfiwqhgigvnrwegew

STUPID HORMONES!!!!

I should really get started on my work now! Totally regretted bringing my laptop, not being productive today, plus, I'm like in the wrong outfit :( BIG BIG SIGH!!!

Note to self:

2011-01-13T01:02:00.001+08:00

Thoughts

2011-01-12T00:06:00.000+08:00

I've decided!

Im gna take a chillpill and just let nature take its course. I'm not gna try and make things happen anymore. If its meant to be, it will be.

On a side note, I should really go get my passport photo re-taken and get it done asap before I get stranded in Singapore and miss out on all the fun!

And I've gotta make a trip down to get a new pair of specs done cus NiNi totally spoilt my current one :(

Okay, time to be productive! Long day ahead tomorrow, must not sleep in lectures!!!

Bye,
xx

SM's 17th!

2011-01-11T02:43:00.000+08:00

Fucking finally!!!

Im finally posting up pictures from SM's 17th celebration! Sheesh man I really failfriend1993 sia!

Anyway, this was so so so so so so long ago Im really sorry bout it! Just that Ive been lazy to sieve thru my pictures and upload it!

Anyhoo, yeah that day was sorta like around our exam day so we didn't really get to celebrate it much. Kinda make me feel guilty cus it feels like Im putting in lesser and lesser effort into my friends' birthdays!

This reminds me, I still owe HLF her present! Stupid girl doesn't want to tell me what she wants :(

Back to topic! So on that day we went SugarLoaf for lunch because I was being an ass and I wanted dessert, and partially because TopTable is full. But I think mainly cus Im an ass.

So yup! The food was okok and we bought like shitload of pastries, like one of each?! Hmmmm pastryyyyy!

And we headed down for lessons and went for din din @ Ajisen! I think its been damn long since I last step foot there!

But the day ended with me and SM "studying" @ Macs and failing miserably.

Omg really failfriend1993 Im sorry Xiao Yuen!

I think I should go bathe and sleep now. Tomorrow's gna be a long day for me!

Goodnight people!

Short update!

2011-01-07T12:44:00.000+08:00

Currently in the school library trying to do my work but clearly I haven't succeeded. Oh time, how I wish you'd freeze for an hour while I do my work. Just one hour, just one!!!

Heading to work later, tomorrow and the day after. Feel so tired just by looking @ my schedule :(

But what irritates me more is my random craving for sweet stuff (esp B&J's!) recently. Boohoo :(

K, today's the 7th, which marks pay day.

Contemplating if I should stop taking allowance from my mum all together. Maybe uh? I'll give it a try.

Okay, time to head back to work, byeeee!

Bangkok

2011-01-06T01:10:00.000+08:00

Finally, after so long, I'm back @ this space!

Yups, been hectic. Tons and tons of project, been busy with work as well.

Feels like I'm still sick and haven't fully recovered, yadda, stuff like that. But I promise I'll try to keep this space alive as much as possible!

Afterall, who doesn't like free $$? Heh!

So this marks this start of my busy schedule, the period of time when I'm hardly at home. My bangkok trip! Right after my papers! So I didn't really have much time to prepare and stuff, I even did my packing only the night before lor!

But I guess unplanned moments are better than planned ones cus I did enjoy (and tire myself out) from all the shopping there!

Man I miss the jap food @ MBK!

Tho its my 2nd time there but I think it was a good 4-5years in between my trips lor!

Jap food @ MBK, hearty sharksfins + birds nest dinner at Chinatown, glazed donut from Mister Donut, grilled corn cob from down the street, 500ml yakult from 7-11 etc! Omg kinda miss the food there cus some are like dirt cheap!

BUT...

The awesome 7-11 burger lost its appeal,

I spent 6k bhats @ chatuchak in one day alone,

I'm dying to try krispy kreme,

I miss the good thai street food,

I bought a pretty Cath Kidson Polka Dot backpack and its now spoilt,

I regretted not buying more stuff from Naraya,

I wish I bought more shoes and bags,

etcetcetc

I'm definitely heading back there again soon, hopefully this year?

But also hopefully when I'm richer cus I feel kinda guilty having my mum pay so much for this trip. I think at the end of the day I only paid half of the trip out of my own pocket?

Okay this is quite a short and abrupt post, gotta face reality and finish up whatever I have cus Im gna be home late for the next few days to come and I got a freaking project submission on Monday!

School early tomorrow, and I need to sort out my feelings :<

Been sucha angsty bitch today tho I did receive a rather pleasant SMS in the morning + evening....

K time to go,

toodles!

TwentyEleven

2011-01-02T02:29:00.034+08:00

I don't know about others but 2010 has been rather good for me!

My temper has been really good this year I think! And I'm starting to pay for most of my own stuff and trying to give my mum a tiny bit of allowance from my pay each month now.

Looking back,

During the post-Os holidays I got my first proper job @ Haji. I thought it'd be fun but the things and people there are much more complicated than I thought.

Then comes entering a new environment - new school, new place, new people, new lifestyle.

Poly is really different from what I expected it to be like and I'm glad I met this bunch of awesome people who stood by me all these while! No doubt some stuff happened in between but its sorta okay now.

Well, sorta, but its really good enough for me already.

I unexpectedly became hardworking and did pretty well for my papers.

And I got a second job, one that felt more real cus it was base on a larger scale of operations.

There I learnt to work with people I didn't like, put up with others' bad and weird habits, to manager a store the systematic way and best of all, I found a group of people I will never forget.

It seems short but it felt like we've been through a lot.

But starting from 3rd quarter this year I also felt that I've been a bad friend. All the time I missed out on hanging out with them just cus of work.

And also starting 3rd quarter of the year was the period where I faced the most "r/ship" problems. I convinced myself that what was real, wasn't right and managed to get out of it.

This time, I'm not gna really set out my New Year Resolutions specificically. You don't have to wait for new year to set goals for yourself. This year I just hope that I will be a better daughter, better friend, better person, juggle my school and work well and stop pinning all my hopes on love.

This year, 2010,

I've grown, I've changed, I've learnt.

I seriously appreciate each and everyone of the people who's been part of my life, standing by me through the many things that happened.

Thank you 2010, for being awesome.

Last night, I had a dream about you.

2010-12-30T03:30:00.002+08:00

Find more artists like DAFT PUNK at Myspace Music

Omg I've been in love with this song ever since I heard it on some sony ad years ago!!!

Keeping my fingers crossed that tomorrow will be awesome and things will go as planned!

Goodnight people, time for my assignments!

xo

2010-12-29T13:51:00.005+08:00

And right now, I wish I have you by my side.

CCN Day!

2010-12-28T05:53:00.000+08:00

HOWDYYYYY!

I know this is kinda late but heres the pictures from CCN day!

Been procrastinating abt blogging cus my room was in a hugeass mess and I wanted to clear it before I laze around. Messy because I itchy hand and took all the clothes out to rearrange.

But anyhoo, managed to clear truckloads of nonsense out as well!

For pre-CCN we sold (ew suddenly felt dejavu) magnolia icecream and for CCN day itself + one day before, we sold Ben & Jerrys!

IKR! ALL THE FATTENING STUFF BUT HOM NOM B&J...... *salivates*

Anyway, I truely and sincerely thank each and everyone of you who came down to support! For those of you who didn't, FUCK YOU!!!

Our sales were pretty awesome but it doesn't really matter cus it goes to charity in the end, so yups, thank you all so much!!!

ALRIGHTO, PICTURE SPAM!

Sighhhhhh, its gna be the end of 2010 and very soon we're gna part. Gonna miss all these girls so much :(

Well in case you don't know, I've been rather busy lately. Its like study, exams, celebration, bangkok, work and today I'm heading to JB! Hahaha omg been like a million years since I last step foot in there i think!

My December has been fucking hectic but at least I made good use of it.

Okay, time to go! I was awake the whole night to pack my room lor! Gna go prep and head out to meet them naoooooo, taking the train, heh so excited.

Take care!

FB Album:

CCN Day

Pre-CCN

Merry Christmas!

2010-12-25T11:02:00.000+08:00

I figured I wouldn't have time to blog before the day ends so I'll just make do with one bigass picture of XNZ first before I upload the pics I took yesterday.

After Christmas will be countdown and the start of a new year, oh how time flies :(

Till then!
Have a very merry Christmas people

xoxo

2010-12-25T02:16:00.000+08:00

MERRY CHRISTMAS!!!!

I'm still alive, trying to finish packing before I update!

Till then!
xoxo

3 more.

2010-12-14T23:09:00.000+08:00

Okay I wasn't even at my lowest point or anything. Didn't feel particularly sad or weak so it was plain pathetic of me to just post the previous post (took it out alr btw). In fact,my mood's been pretty good lately!

I'm sorry this has absolutely nothing to do with my previous r/ship or whatsoever. Neither does the "fb r/ship deactivate" quote have anything to do with my own r/ship.

I just chanced upon it and felt that it really describes what my friend told me? So don't read too much into it!

Anyhoo, I'm barely halfway thru my papers yet I'm starting to laze and slack.

Been browsing all the online store omg so tempted to buy things but I gotta feeling (that tonight's gna be a good good night~ okay sorry for sidetracking) that I'm not gna have enough money for this festive season leh?!

Tomorrow's accounting which I (am suppose to) have absolute confidence of, but apparently the C now stands for complacent and I don't like it!

Thurs and Fri will be open book so its quite a relief heh! Meeting WW tomorrow and gna go out with my lovely classmates on Fri!

Can't wait~~~

But for now, books notes and practice papers!!!!!

Till then!

2010-12-10T02:17:00.002+08:00

"The love you had for your ex isn’t the same as with someone new, each love is different. I think the love is just “inactive”; you can’t delete someone you truly loved. It’s almost like a facebook account, you can just inactivate your account, never delete it. If you want to and the time is right you can recreate it, but the pages have changed and so have you. "

Omg just came across it, so mad true!

Okay anyway I think I pretty much salvaged my psychology quiz with my awesome pawsome near-to-perfect score for my last 3 quizes! So... yay me! I got 135pts for my IQ test okay! This means I'm above average so suck it! YJ doesn't believe that I'm moving towards being a genius, beh!

Besides being hectic, I'm still being panicky. Keeping my fingers crossed that I will finish studying everything!

Goodnight sweetangels, I'm heading off to do my work now!
Feel so happy heh,
lots of love!

Countdown

2010-12-08T09:56:00.001+08:00

How time flies, its Wednesday already! Of course this means that the end is nearing, but at the same time it meant that there's lesser time to study!! :( Feels like everything is halfway through and I"m not really done with anything.

Talk about time management, sheesh. Owells, 9 more days till next friday!!!

Heh, just bought this cute notebook yesterday cus I lost the other one @ work :( Now I can't wait to use it!

So in love with my current nail colour!

Woke up and found this 4-leaf clover keychain on the table with my mum's note attached to it. Its really nice but at the same time stupid cus clovers are suppose to be some lucky thing! You find it BY CHANCE!

How is it possible that theres thousands and millions of it being sold huh!

Anyway, I've gotten my pay heh, need to ib to give my mum some money and do some online shopping before I start studying (pls be productive)!

Hope my mum's friend brought something back from Europe for me!!!!